SCOPe 2.07: Domain d4hjoa_: 4hjo A:

Lineage for d4hjoa_ (4hjo A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
   PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82796] (129 PDB entries)
   Uniprot P00533 702-1018

8. Domain d4hjoa_: 4hjo A: [194321]
   automated match to d1m14a_
   complexed with aq4

Details for d4hjoa_

PDB Entry: 4hjo, 2.75 Å

PDB Description: Crystal structure of the inactive EGFR tyrosine kinase domain with erlotinib

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4hjoa_:

Sequence, based on SEQRES records:

>d4hjoa_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
llrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeilde
ayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqia
kgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwma
lesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictid
vymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

Sequence, based on observed residues (ATOM records):

>d4hjoa_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
llrilketefkkikvlgsgafgtvykglwipvkipvaikelreatspkankeildeayvm
asvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmn
yledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesi
lhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymi
mrkcwmidadsrpkfreliiefskmardpqrylviqgd

Timeline for d4hjoa_:

• d4hjoa_ first appeared in SCOPe 2.02
  
• d4hjoa_ appears in SCOPe 2.06
  
• d4hjoa_ appears in the current release, SCOPe 2.08