Lineage for d1c3cb_ (1c3c B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010266Protein Adenylosuccinate lyase [48568] (3 species)
  7. 2010274Species Thermotoga maritima [TaxId:2336] [48569] (2 PDB entries)
  8. 2010276Domain d1c3cb_: 1c3c B: [19426]

Details for d1c3cb_

PDB Entry: 1c3c (more details), 1.8 Å

PDB Description: t. maritima adenylosuccinate lyase
PDB Compounds: (B:) protein (adenylosuccinate lyase)

SCOPe Domain Sequences for d1c3cb_:

Sequence, based on SEQRES records: (download)

>d1c3cb_ a.127.1.1 (B:) Adenylosuccinate lyase {Thermotoga maritima [TaxId: 2336]}
veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
hlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwher
dishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkl
iekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhv
dhiferfek

Sequence, based on observed residues (ATOM records): (download)

>d1c3cb_ a.127.1.1 (B:) Adenylosuccinate lyase {Thermotoga maritima [TaxId: 2336]}
veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
hlqrtevleveepfrksamphkknpitcerltglsrmmrayvdpslenialwherdishs
sveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekgl
trkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhife
rfek

SCOPe Domain Coordinates for d1c3cb_:

Click to download the PDB-style file with coordinates for d1c3cb_.
(The format of our PDB-style files is described here.)

Timeline for d1c3cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c3ca_