PDB entry 1c3c

View 1c3c on RCSB PDB site
Description: t. maritima adenylosuccinate lyase
Class: lyase
Keywords: purine biosynthesis, lyase
Deposited on 1999-07-27, released 2000-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (adenylosuccinate lyase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0I0 (0-428)
    • GB AAD36171 (0-428)
    Domains in SCOPe 2.07: d1c3ca_
  • Chain 'B':
    Compound: protein (adenylosuccinate lyase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0I0 (0-428)
    • GB AAD36171 (0-428)
    Domains in SCOPe 2.07: d1c3cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c3cA (A:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwher
    dishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkl
    iekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhv
    dhiferfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3cA (A:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrksamphkknpitcerltglsrmmrayvdpslenialwherdishs
    sveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekgl
    trkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhife
    rfek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c3cB (B:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwher
    dishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkl
    iekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhv
    dhiferfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3cB (B:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrksamphkknpitcerltglsrmmrayvdpslenialwherdishs
    sveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekgl
    trkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhife
    rfek