Lineage for d3uirc_ (3uir C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259689Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2259690Protein automated matches [190829] (11 species)
    not a true protein
  7. 2259738Species Pseudonaja textilis [TaxId:169397] [188742] (3 PDB entries)
  8. 2259743Domain d3uirc_: 3uir C: [194177]
    Other proteins in same PDB: d3uira_, d3uirb_
    automated match to d3bybb_
    complexed with so4

Details for d3uirc_

PDB Entry: 3uir (more details), 2.78 Å

PDB Description: Crystal structure of the plasmin-textilinin-1 complex
PDB Compounds: (C:) Textilinin-1

SCOPe Domain Sequences for d3uirc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uirc_ g.8.1.0 (C:) automated matches {Pseudonaja textilis [TaxId: 169397]}
rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca

SCOPe Domain Coordinates for d3uirc_:

Click to download the PDB-style file with coordinates for d3uirc_.
(The format of our PDB-style files is described here.)

Timeline for d3uirc_: