Lineage for d3bybb_ (3byb B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259689Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2259690Protein automated matches [190829] (11 species)
    not a true protein
  7. 2259738Species Pseudonaja textilis [TaxId:169397] [188742] (3 PDB entries)
  8. 2259740Domain d3bybb_: 3byb B: [172930]
    automated match to d1jc6a_
    complexed with etx, so4

Details for d3bybb_

PDB Entry: 3byb (more details), 1.63 Å

PDB Description: Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom
PDB Compounds: (B:) Textilinin

SCOPe Domain Sequences for d3bybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bybb_ g.8.1.0 (B:) automated matches {Pseudonaja textilis [TaxId: 169397]}
drpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa

SCOPe Domain Coordinates for d3bybb_:

Click to download the PDB-style file with coordinates for d3bybb_.
(The format of our PDB-style files is described here.)

Timeline for d3bybb_: