SCOPe 2.07: Domain d4gkfb_: 4gkf B:

Lineage for d4gkfb_ (4gkf B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
   core: 5 helices; bundle

4. Superfamily a.70.2: AF1862-like [158568] (2 families)
   probable biological unit is a hexamer

5. Family a.70.2.0: automated matches [194080] (1 protein)
   not a true family

6. Protein automated matches [194081] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [194106] (1 PDB entry)

8. Domain d4gkfb_: 4gkf B: [194108]
   automated match to d2oeba1

Details for d4gkfb_

PDB Entry: 4gkf, 2.1 Å

PDB Description: Crystal structure and characterization of Cmr5 protein from Pyrococcus furiosus

PDB Compounds: (B:) CRISPR system Cmr subunit Cmr5

SCOPe Domain Sequences for d4gkfb_:

Sequence; same for both SEQRES and ATOM records:

>d4gkfb_ a.70.2.0 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
irktleqrrgeyayyvikevadlndkqleekyaslvkkapvmilsngllqtlafllakae
tspekanqilsrvneypprfieklgndkdehlllylhivywlrenvdrnidvktllsqdy
skvlwatkeaiallnwmrrfavamlke

Timeline for d4gkfb_:

• d4gkfb_ first appeared in SCOPe 2.02
  
• d4gkfb_ appears in SCOPe 2.06
  
• d4gkfb_ appears in the current release, SCOPe 2.08