Lineage for d4gkfb_ (4gkf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717753Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
    core: 5 helices; bundle
  4. 2717760Superfamily a.70.2: AF1862-like [158568] (2 families) (S)
    probable biological unit is a hexamer
  5. 2717765Family a.70.2.0: automated matches [194080] (1 protein)
    not a true family
  6. 2717766Protein automated matches [194081] (1 species)
    not a true protein
  7. 2717767Species Pyrococcus furiosus [TaxId:186497] [194106] (1 PDB entry)
  8. 2717769Domain d4gkfb_: 4gkf B: [194108]
    automated match to d2oeba1

Details for d4gkfb_

PDB Entry: 4gkf (more details), 2.1 Å

PDB Description: Crystal structure and characterization of Cmr5 protein from Pyrococcus furiosus
PDB Compounds: (B:) CRISPR system Cmr subunit Cmr5

SCOPe Domain Sequences for d4gkfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gkfb_ a.70.2.0 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
irktleqrrgeyayyvikevadlndkqleekyaslvkkapvmilsngllqtlafllakae
tspekanqilsrvneypprfieklgndkdehlllylhivywlrenvdrnidvktllsqdy
skvlwatkeaiallnwmrrfavamlke

SCOPe Domain Coordinates for d4gkfb_:

Click to download the PDB-style file with coordinates for d4gkfb_.
(The format of our PDB-style files is described here.)

Timeline for d4gkfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4gkfa_