Lineage for d4eopa_ (4eop A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672328Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1672329Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries)
    Uniprot P24941
  8. 1672519Domain d4eopa_: 4eop A: [194038]
    Other proteins in same PDB: d4eopb1, d4eopb2, d4eopd1, d4eopd2
    automated match to d3bhta_
    complexed with 1ro, mg, sgm

Details for d4eopa_

PDB Entry: 4eop (more details), 1.99 Å

PDB Description: Thr 160 phosphorylated CDK2 Q131E - human cyclin A3 complex with the inhibitor RO3306
PDB Compounds: (A:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eopa_:

Sequence, based on SEQRES records: (download)

>d4eopa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
chshrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d4eopa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d4eopa_:

Click to download the PDB-style file with coordinates for d4eopa_.
(The format of our PDB-style files is described here.)

Timeline for d4eopa_: