Lineage for d4j11a1 (4j11 A:1-85)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1992656Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 1992670Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 1992671Protein automated matches [193225] (4 species)
    not a true protein
  7. 1992672Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries)
  8. 1992675Domain d4j11a1: 4j11 A:1-85 [194002]
    Other proteins in same PDB: d4j11a2, d4j11b2, d4j11c2
    automated match to d3favc_

Details for d4j11a1

PDB Entry: 4j11 (more details), 1.44 Å

PDB Description: The crystal structure of a secreted protein ESXB (wild-type, in P21 space group) from Bacillus anthracis str. sterne
PDB Compounds: (A:) Secreted protein EsxB

SCOPe Domain Sequences for d4j11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j11a1 a.25.3.0 (A:1-85) automated matches {Bacillus anthracis [TaxId: 260799]}
maeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskq
amqqyipilegistdlkriadkfrn

SCOPe Domain Coordinates for d4j11a1:

Click to download the PDB-style file with coordinates for d4j11a1.
(The format of our PDB-style files is described here.)

Timeline for d4j11a1: