| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
| Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
| Protein automated matches [193225] (4 species) not a true protein |
| Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries) |
| Domain d4j11a1: 4j11 A:1-85 [194002] Other proteins in same PDB: d4j11a2, d4j11b2, d4j11c2 automated match to d3favc_ |
PDB Entry: 4j11 (more details), 1.44 Å
SCOPe Domain Sequences for d4j11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j11a1 a.25.3.0 (A:1-85) automated matches {Bacillus anthracis [TaxId: 260799]}
maeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskq
amqqyipilegistdlkriadkfrn
Timeline for d4j11a1: