| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries) |
| Domain d4irod_: 4iro D: [193972] Other proteins in same PDB: d4iroa_, d4iroc_ automated match to d2h8fb_ complexed with cmo, hem |
PDB Entry: 4iro (more details), 2.2 Å
SCOPe Domain Sequences for d4irod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irod_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh
Timeline for d4irod_: