SCOPe 2.07: Domain d4e90a1: 4e90 A:182-505

Lineage for d4e90a1 (4e90 A:182-505)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
   Uniprot O76083 241-566

8. Domain d4e90a1: 4e90 A:182-505 [193959]
   Other proteins in same PDB: d4e90a2, d4e90b2
   automated match to d3dy8a_
   complexed with 7rg, mg, zn

Details for d4e90a1

PDB Entry: 4e90, 2.5 Å

PDB Description: Human phosphodiesterase 9 in complex with inhibitors

PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4e90a1:

Sequence; same for both SEQRES and ATOM records:

>d4e90a1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

Timeline for d4e90a1:

• d4e90a1 first appeared in SCOPe 2.02, called d4e90a_
  
• d4e90a1 appears in SCOPe 2.06
  
• d4e90a1 appears in the current release, SCOPe 2.08