![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries) Uniprot O76083 241-566 |
![]() | Domain d4e90a1: 4e90 A:182-505 [193959] Other proteins in same PDB: d4e90a2, d4e90b2 automated match to d3dy8a_ complexed with 7rg, mg, zn |
PDB Entry: 4e90 (more details), 2.5 Å
SCOPe Domain Sequences for d4e90a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e90a1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]} typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq plwesrdryeelkriddamkelqk
Timeline for d4e90a1: