Lineage for d4emna_ (4emn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1633955Family d.2.1.8: RPF-like [159824] (2 proteins)
    Pfam PF06737; Transglycosylase-like domain
  6. 1633959Protein automated matches [193952] (1 species)
    not a true protein
  7. 1633960Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries)
  8. 1633961Domain d4emna_: 4emn A: [193957]
    automated match to d1xsfa1
    complexed with ben, so4

Details for d4emna_

PDB Entry: 4emn (more details), 1.17 Å

PDB Description: Crystal structure of RpfB catalytic domain in complex with benzamidine
PDB Compounds: (A:) Probable resuscitation-promoting factor rpfB

SCOPe Domain Sequences for d4emna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emna_ d.2.1.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gsiwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavae
vtrlrqgwgawpvcaaragar

SCOPe Domain Coordinates for d4emna_:

Click to download the PDB-style file with coordinates for d4emna_.
(The format of our PDB-style files is described here.)

Timeline for d4emna_: