![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.8: RPF-like [159824] (2 proteins) Pfam PF06737; Transglycosylase-like domain |
![]() | Protein automated matches [193952] (1 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries) |
![]() | Domain d4emna_: 4emn A: [193957] automated match to d1xsfa1 complexed with ben, so4 |
PDB Entry: 4emn (more details), 1.17 Å
SCOPe Domain Sequences for d4emna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4emna_ d.2.1.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} gsiwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavae vtrlrqgwgawpvcaaragar
Timeline for d4emna_: