SCOP 1.57: Domain d1e7ba2: 1e7b A:197-388

Lineage for d1e7ba2 (1e7b A:197-388)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.126: Serum albumin [48551] (1 superfamily)

4. Superfamily a.126.1: Serum albumin [48552] (1 family)

5. Family a.126.1.1: Serum albumin [48553] (1 protein)

6. Protein Serum albumin [48554] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (16 PDB entries)

8. Domain d1e7ba2: 1e7b A:197-388 [19391]

Details for d1e7ba2

PDB Entry: 1e7b, 2.38 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic halothane

SCOP Domain Sequences for d1e7ba2:

Sequence; same for both SEQRES and ATOM records:

>d1e7ba2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens)}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d1e7ba2:

• d1e7ba2 first appeared (with stable ids) in SCOP 1.55
  
• d1e7ba2 appears in SCOP 1.59
  
• d1e7ba2 appears in the current release, SCOPe 2.08