Lineage for d1e7bb3 (1e7b B:389-580)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50986Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 50987Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 50988Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 50989Protein Serum albumin [48554] (1 species)
  7. 50990Species Human (Homo sapiens) [TaxId:9606] [48555] (16 PDB entries)
  8. 51044Domain d1e7bb3: 1e7b B:389-580 [19395]

Details for d1e7bb3

PDB Entry: 1e7b (more details), 2.38 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic halothane

SCOP Domain Sequences for d1e7bb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7bb3 a.126.1.1 (B:389-580) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasq

SCOP Domain Coordinates for d1e7bb3:

Click to download the PDB-style file with coordinates for d1e7bb3.
(The format of our PDB-style files is described here.)

Timeline for d1e7bb3: