Lineage for d1e7ba2 (1e7b A:197-388)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. Domain d1e7ba2: 1e7b A:197-388 [19391]
    complexed with hlt

Details for d1e7ba2

PDB Entry: 1e7b (more details), 2.38 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic halothane
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1e7ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ba2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d1e7ba2 are not available.

Timeline for d1e7ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e7ba1, d1e7ba3
View in 3D
Domains from other chains:
(mouse over for more information)
d1e7bb1, d1e7bb2, d1e7bb3