Lineage for d3w32a_ (3w32 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981114Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981115Species Human (Homo sapiens) [TaxId:9606] [82796] (133 PDB entries)
    Uniprot P00533 702-1018
  8. 2981119Domain d3w32a_: 3w32 A: [193901]
    automated match to d2gs6a_
    complexed with so4, w32

Details for d3w32a_

PDB Entry: 3w32 (more details), 1.8 Å

PDB Description: EGFR kinase domain complexed with compound 20a
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3w32a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w32a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
deayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvq
iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
idvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyra
lmdeedmddvvdadeyl

SCOPe Domain Coordinates for d3w32a_:

Click to download the PDB-style file with coordinates for d3w32a_.
(The format of our PDB-style files is described here.)

Timeline for d3w32a_: