PDB entry 3w32

View 3w32 on RCSB PDB site
Description: EGFR kinase domain complexed with compound 20a
Class: transferase/transferase inhibitor
Keywords: ANTI-ONCOGENE, CELL CYCLE, DISEASE MUTATION, KINASE DOMAIN, RECEPTOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-12-07, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w32a_
  • Heterogens: W32, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w32A (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w32A (A:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
    malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
    idvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyra
    lmdeedmddvvdadeyl