Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
Protein automated matches [190903] (18 species) not a true protein |
Species Leishmania major [TaxId:5664] [225634] (3 PDB entries) |
Domain d3b64a_: 3b64 A: [193895] automated match to d2xcza_ complexed with ipa |
PDB Entry: 3b64 (more details), 1.03 Å
SCOPe Domain Sequences for d3b64a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b64a_ d.80.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]} pviqtfvstpldhhkrenlaqvyravtrdvlgkpedlvmmtfhdstpmhffgstdpvacv rvealggygpsepekvtsivtaaitkecgivadrifvlyfsplhcgwngtnf
Timeline for d3b64a_: