Lineage for d3b64a_ (3b64 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210202Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1210203Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1210500Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 1210501Protein automated matches [190903] (11 species)
    not a true protein
  7. 1210533Species Leishmania major [TaxId:5664] [193894] (1 PDB entry)
  8. 1210534Domain d3b64a_: 3b64 A: [193895]
    automated match to d2xcza_
    complexed with ipa

Details for d3b64a_

PDB Entry: 3b64 (more details), 1.03 Å

PDB Description: Macrophage Migration Inhibitory Factor (MIF) From /Leishmania Major
PDB Compounds: (A:) Macrophage migration inhibitory factor-like protein

SCOPe Domain Sequences for d3b64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b64a_ d.80.1.0 (A:) automated matches {Leishmania major}
pviqtfvstpldhhkrenlaqvyravtrdvlgkpedlvmmtfhdstpmhffgstdpvacv
rvealggygpsepekvtsivtaaitkecgivadrifvlyfsplhcgwngtnf

SCOPe Domain Coordinates for d3b64a_:

Click to download the PDB-style file with coordinates for d3b64a_.
(The format of our PDB-style files is described here.)

Timeline for d3b64a_: