SCOPe 2.04: Domain d4hupx_: 4hup X:

Lineage for d4hupx_ (4hup X:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Ricin A-chain [56389] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (37 PDB entries)
   Uniprot P06750 28-286

8. Domain d4hupx_: 4hup X: [193759]
   automated match to d1br5a_
   complexed with 19m, mla, so4

Details for d4hupx_

PDB Entry: 4hup, 1.7 Å

PDB Description: structure of ricin a chain bound with n-(n-(pterin-7-yl) carbonylglycyl)-l-phenylalanyl)-l-phenylalanine

PDB Compounds: (X:) ricin

SCOPe Domain Sequences for d4hupx_:

Sequence; same for both SEQRES and ATOM records:

>d4hupx_ d.165.1.1 (X:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcapppssqf

Timeline for d4hupx_:

• d4hupx_ first appeared in SCOPe 2.02
  
• d4hupx_ appears in SCOPe 2.03
  
• d4hupx_ appears in SCOPe 2.05
  
• d4hupx_ appears in the current release, SCOPe 2.08