Lineage for d4hupx_ (4hup X:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681240Protein Ricin A-chain [56389] (1 species)
  7. 1681241Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (37 PDB entries)
    Uniprot P06750 28-286
  8. 1681248Domain d4hupx_: 4hup X: [193759]
    automated match to d1br5a_
    complexed with 19m, mla, so4

Details for d4hupx_

PDB Entry: 4hup (more details), 1.7 Å

PDB Description: structure of ricin a chain bound with n-(n-(pterin-7-yl) carbonylglycyl)-l-phenylalanyl)-l-phenylalanine
PDB Compounds: (X:) ricin

SCOPe Domain Sequences for d4hupx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hupx_ d.165.1.1 (X:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d4hupx_:

Click to download the PDB-style file with coordinates for d4hupx_.
(The format of our PDB-style files is described here.)

Timeline for d4hupx_: