SCOPe 2.06: Domain d3n07d_: 3n07 D:

Lineage for d3n07d_ (3n07 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (51 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [193720] (1 PDB entry)

8. Domain d3n07d_: 3n07 D: [193721]
   automated match to d3n1ua_
   complexed with mg

Details for d3n07d_

PDB Entry: 3n07, 1.76 Å

PDB Description: structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae

PDB Compounds: (D:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3n07d_:

Sequence; same for both SEQRES and ATOM records:

>d3n07d_ c.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
stvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvkal
mnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyigd
dlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneldv

Timeline for d3n07d_:

• d3n07d_ first appeared in SCOPe 2.02
  
• d3n07d_ appears in SCOPe 2.05
  
• d3n07d_ appears in SCOPe 2.07
  
• d3n07d_ appears in the current release, SCOPe 2.08