Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (25 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [193720] (1 PDB entry) |
Domain d3n07d_: 3n07 D: [193721] automated match to d3n1ua_ complexed with mg |
PDB Entry: 3n07 (more details), 1.76 Å
SCOPe Domain Sequences for d3n07d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n07d_ c.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]} stvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvkal mnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyigd dlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneldv
Timeline for d3n07d_: