Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein automated matches [190152] (25 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [193632] (1 PDB entry) |
Domain d3tqxb_: 3tqx B: [193633] automated match to d1fc4a_ complexed with plp |
PDB Entry: 3tqx (more details), 2.3 Å
SCOPe Domain Sequences for d3tqxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqxb_ c.67.1.4 (B:) automated matches {Coxiella burnetii [TaxId: 227377]} mqeilsqlnkeieglkkaglykseriitspqnaeikvgekevlnfcannylgladhpali ktaqtvveqygfgmasvrficgtqtihkelekdiseflgtddtilysscfdangglfetl lgpedaiisdelnhasiidgirlckaqryryknnamgdleaklkeadekgarfkliatdg vfsmdgiiadlksicdladkynalvmvddshavgfigengrgtpeycgvadrvdiltgtl gkalggasggytsghkeiiewlrnrsrpylfsntvapvivatslkvlellktegpqlrkq lqensryfragmeklgfqlvpgnhpiipvmlgdaqlatnmadhllqegiyvvgfsypvvp mgkarirvqmsavhtqqqldraieafgqvgkklgai
Timeline for d3tqxb_: