SCOPe 2.07: Domain d3tqxb_: 3tqx B:

Lineage for d3tqxb_ (3tqx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (25 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [193632] (1 PDB entry)

8. Domain d3tqxb_: 3tqx B: [193633]
   automated match to d1fc4a_
   complexed with plp

Details for d3tqxb_

PDB Entry: 3tqx, 2.3 Å

PDB Description: structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii

PDB Compounds: (B:) 2-amino-3-ketobutyrate coenzyme A ligase

SCOPe Domain Sequences for d3tqxb_:

Sequence; same for both SEQRES and ATOM records:

>d3tqxb_ c.67.1.4 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
mqeilsqlnkeieglkkaglykseriitspqnaeikvgekevlnfcannylgladhpali
ktaqtvveqygfgmasvrficgtqtihkelekdiseflgtddtilysscfdangglfetl
lgpedaiisdelnhasiidgirlckaqryryknnamgdleaklkeadekgarfkliatdg
vfsmdgiiadlksicdladkynalvmvddshavgfigengrgtpeycgvadrvdiltgtl
gkalggasggytsghkeiiewlrnrsrpylfsntvapvivatslkvlellktegpqlrkq
lqensryfragmeklgfqlvpgnhpiipvmlgdaqlatnmadhllqegiyvvgfsypvvp
mgkarirvqmsavhtqqqldraieafgqvgkklgai

Timeline for d3tqxb_:

• d3tqxb_ first appeared in SCOPe 2.02
  
• d3tqxb_ appears in SCOPe 2.06
  
• d3tqxb_ appears in the current release, SCOPe 2.08