Lineage for d3tqxb_ (3tqx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896406Species Coxiella burnetii [TaxId:227377] [193632] (1 PDB entry)
  8. 2896408Domain d3tqxb_: 3tqx B: [193633]
    automated match to d1fc4a_
    complexed with plp

Details for d3tqxb_

PDB Entry: 3tqx (more details), 2.3 Å

PDB Description: structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii
PDB Compounds: (B:) 2-amino-3-ketobutyrate coenzyme A ligase

SCOPe Domain Sequences for d3tqxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqxb_ c.67.1.4 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
mqeilsqlnkeieglkkaglykseriitspqnaeikvgekevlnfcannylgladhpali
ktaqtvveqygfgmasvrficgtqtihkelekdiseflgtddtilysscfdangglfetl
lgpedaiisdelnhasiidgirlckaqryryknnamgdleaklkeadekgarfkliatdg
vfsmdgiiadlksicdladkynalvmvddshavgfigengrgtpeycgvadrvdiltgtl
gkalggasggytsghkeiiewlrnrsrpylfsntvapvivatslkvlellktegpqlrkq
lqensryfragmeklgfqlvpgnhpiipvmlgdaqlatnmadhllqegiyvvgfsypvvp
mgkarirvqmsavhtqqqldraieafgqvgkklgai

SCOPe Domain Coordinates for d3tqxb_:

Click to download the PDB-style file with coordinates for d3tqxb_.
(The format of our PDB-style files is described here.)

Timeline for d3tqxb_: