Lineage for d3bwvb_ (3bwv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920653Species Staphylococcus epidermidis [TaxId:176280] [193618] (1 PDB entry)
  8. 2920655Domain d3bwvb_: 3bwv B: [193619]
    automated match to d2i7da_
    complexed with cl, mg

Details for d3bwvb_

PDB Entry: 3bwv (more details), 1.55 Å

PDB Description: crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution
PDB Compounds: (B:) Putative 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d3bwvb_:

Sequence, based on SEQRES records: (download)

>d3bwvb_ c.108.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
rqriaidmdevladtlgavvkavneradlnikmeslngkklkhmipeheglvmdilkepg
ffrnldvmphaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcg
rkniiladyliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie

Sequence, based on observed residues (ATOM records): (download)

>d3bwvb_ c.108.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
rqriaidmdevladtlgavvkavneradlnikmeslngkklglvmdilkepgffrnldvm
phaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcgrkniilad
yliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie

SCOPe Domain Coordinates for d3bwvb_:

Click to download the PDB-style file with coordinates for d3bwvb_.
(The format of our PDB-style files is described here.)

Timeline for d3bwvb_: