SCOPe 2.08: Domain d3bwvb_: 3bwv B:

Lineage for d3bwvb_ (3bwv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176280] [193618] (1 PDB entry)

8. Domain d3bwvb_: 3bwv B: [193619]
   automated match to d2i7da_
   complexed with cl, mg

Details for d3bwvb_

PDB Entry: 3bwv, 1.55 Å

PDB Description: crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution

PDB Compounds: (B:) Putative 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d3bwvb_:

Sequence, based on SEQRES records:

>d3bwvb_ c.108.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
rqriaidmdevladtlgavvkavneradlnikmeslngkklkhmipeheglvmdilkepg
ffrnldvmphaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcg
rkniiladyliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie

Sequence, based on observed residues (ATOM records):

>d3bwvb_ c.108.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
rqriaidmdevladtlgavvkavneradlnikmeslngkklglvmdilkepgffrnldvm
phaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcgrkniilad
yliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie

Timeline for d3bwvb_:

• d3bwvb_ first appeared in SCOPe 2.02
  
• d3bwvb_ appears in SCOPe 2.07