PDB entry 3bwv

View 3bwv on RCSB PDB site
Description: Crystal structure of deoxyribonucleotidase-like protein (NP_764060.1) from Staphylococcus epidermidis ATCC 12228 at 1.55 A resolution
Class: hydrolase
Keywords: NP_764060.1, deoxyribonucleotidase-like protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Hydrolase
Deposited on 2008-01-10, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 5'(3')-deoxyribonucleotidase
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: NP_764060.1, SE_0505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bwva_
  • Chain 'B':
    Compound: Putative 5'(3')-deoxyribonucleotidase
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: NP_764060.1, SE_0505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bwvb_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bwvA (A:)
    gmtrqriaidmdevladtlgavvkavneradlnikmeslngkklkhmipeheglvmdilk
    epgffrnldvmphaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfv
    fcgrkniiladyliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwvA (A:)
    trqriaidmdevladtlgavvkavneradlnikmeslngkklglvmdilkepgffrnldv
    mphaqevvkqlnehydiyiataavptsfhdkyewlleyfpfldpqhfvfcgrkniilady
    liddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bwvB (B:)
    gmtrqriaidmdevladtlgavvkavneradlnikmeslngkklkhmipeheglvmdilk
    epgffrnldvmphaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfv
    fcgrkniiladyliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bwvB (B:)
    rqriaidmdevladtlgavvkavneradlnikmeslngkklglvmdilkepgffrnldvm
    phaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcgrkniilad
    yliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie