Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (25 species) not a true protein |
Species Staphylococcus epidermidis [TaxId:176280] [193618] (1 PDB entry) |
Domain d3bwvb_: 3bwv B: [193619] automated match to d2i7da_ complexed with cl, mg |
PDB Entry: 3bwv (more details), 1.55 Å
SCOPe Domain Sequences for d3bwvb_:
Sequence, based on SEQRES records: (download)
>d3bwvb_ c.108.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} rqriaidmdevladtlgavvkavneradlnikmeslngkklkhmipeheglvmdilkepg ffrnldvmphaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcg rkniiladyliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie
>d3bwvb_ c.108.1.0 (B:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} rqriaidmdevladtlgavvkavneradlnikmeslngkklglvmdilkepgffrnldvm phaqevvkqlnehydiyiataamdvptsfhdkyewlleyfpfldpqhfvfcgrkniilad yliddnpkqleifegksimftashnvyehrfervsgwrdvknyfnsie
Timeline for d3bwvb_: