![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.12: Haloperoxidase [53531] (8 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
![]() | Protein automated matches [190860] (3 species) not a true protein |
![]() | Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries) |
![]() | Domain d3t52b_: 3t52 B: [193607] automated match to d1va4a_ complexed with act, cl, gol, peo, so4; mutant |
PDB Entry: 3t52 (more details), 2 Å
SCOPe Domain Sequences for d3t52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t52b_ c.69.1.12 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]} stfvakdgtqiyfkdwgsgkpvlfshgwildadmweyqmeylssrgyrtiafdrrgfgrs dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg aelkvykdaphgfavthaqqlnedllaflkr
Timeline for d3t52b_: