SCOPe 2.08: Domain d1ao6a3: 1ao6 A:389-582

Lineage for d1ao6a3 (1ao6 A:389-582)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
   Uniprot P02768 29-596

8. Domain d1ao6a3: 1ao6 A:389-582 [19356]

Details for d1ao6a3

PDB Entry: 1ao6, 2.5 Å

PDB Description: crystal structure of human serum albumin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1ao6a3:

Sequence; same for both SEQRES and ATOM records:

>d1ao6a3 a.126.1.1 (A:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d1ao6a3:

• d1ao6a3 first appeared (with stable ids) in SCOP 1.55
  
• d1ao6a3 appears in SCOPe 2.07