Lineage for d1ao6b1 (1ao6 B:5-196)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. Domain d1ao6b1: 1ao6 B:5-196 [19357]

Details for d1ao6b1

PDB Entry: 1ao6 (more details), 2.5 Å

PDB Description: crystal structure of human serum albumin
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d1ao6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao6b1 a.126.1.1 (B:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

SCOPe Domain Coordinates for d1ao6b1 are not available.

Timeline for d1ao6b1:

Domains from same chain:
(mouse over for more information)
d1ao6b2, d1ao6b3
Domains from other chains:
(mouse over for more information)
d1ao6a1, d1ao6a2, d1ao6a3