SCOPe 2.07: Domain d4aihe_: 4aih E:

Lineage for d4aihe_ (4aih E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (6 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:502800] [193529] (1 PDB entry)

8. Domain d4aihe_: 4aih E: [193530]
   automated match to d3q5fa_

Details for d4aihe_

PDB Entry: 4aih, 2.4 Å

PDB Description: Crystal structure of RovA from Yersinia in its free form

PDB Compounds: (E:) Transcriptional regulator slyA

SCOPe Domain Sequences for d4aihe_:

Sequence, based on SEQRES records:

>d4aihe_ a.4.5.28 (E:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps
lvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggissde
iavlsglidklekniiqlq

Sequence, based on observed residues (ATOM records):

>d4aihe_ a.4.5.28 (E:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps
lvrtldqleekglitrhtkriklteqsspiieqvdgvisstrkeilggissdeiavlsgl
idklekniiqlq

Timeline for d4aihe_:

• d4aihe_ first appeared in SCOPe 2.02
  
• d4aihe_ appears in SCOPe 2.06
  
• d4aihe_ appears in the current release, SCOPe 2.08