![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein automated matches [190294] (6 species) not a true protein |
![]() | Species Yersinia pseudotuberculosis [TaxId:502800] [193529] (1 PDB entry) |
![]() | Domain d4aihe_: 4aih E: [193530] automated match to d3q5fa_ |
PDB Entry: 4aih (more details), 2.4 Å
SCOPe Domain Sequences for d4aihe_:
Sequence, based on SEQRES records: (download)
>d4aihe_ a.4.5.28 (E:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]} stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps lvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggissde iavlsglidklekniiqlq
>d4aihe_ a.4.5.28 (E:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]} stlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqps lvrtldqleekglitrhtkriklteqsspiieqvdgvisstrkeilggissdeiavlsgl idklekniiqlq
Timeline for d4aihe_: