Lineage for d1f0jb_ (1f0j B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2018992Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2018996Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 2018997Species Human (Homo sapiens) [TaxId:9606] [48550] (30 PDB entries)
    Uniprot Q07343 324-667
  8. 2019002Domain d1f0jb_: 1f0j B: [19347]
    complexed with ars, mg, zn

Details for d1f0jb_

PDB Entry: 1f0j (more details), 1.77 Å

PDB Description: catalytic domain of human phosphodiesterase 4b2b
PDB Compounds: (B:) phosphodiesterase 4b

SCOPe Domain Sequences for d1f0jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0jb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqap

SCOPe Domain Coordinates for d1f0jb_:

Click to download the PDB-style file with coordinates for d1f0jb_.
(The format of our PDB-style files is described here.)

Timeline for d1f0jb_: