Lineage for d1f0jb_ (1f0j B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.125: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48546] (1 superfamily) Superfamily a.125.1: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48547] (1 family) 
Family a.125.1.1: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48548] (1 protein) Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48550] (1 PDB entry) 
Domain d1f0jb_: 1f0j B: [19347]
Details for d1f0jb_
PDB Entry: 1f0j (more details), 1.77 Å
PDB Description: catalytic domain of human phosphodiesterase 4b2b
SCOP Domain Sequences for d1f0jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f0jb_ a.125.1.1 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens)}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqap
SCOP Domain Coordinates for d1f0jb_:
Click to download the PDB-style file with coordinates for d1f0jb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f0jb_:
- d1f0jb_ appears in SCOP 1.57
- d1f0jb_ appears in the current release, SCOPe 2.08
View in 3D
