Lineage for d4h9ya_ (4h9y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (26 species)
    not a true protein
  7. 2084995Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries)
  8. 2085013Domain d4h9ya_: 4h9y A: [193070]
    automated match to d3ojga_
    complexed with fe, oh, zn; mutant

Details for d4h9ya_

PDB Entry: 4h9y (more details), 2.08 Å

PDB Description: Structure of Geobacillus kaustophilus lactonase, mutant E101N with Zn2+
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d4h9ya_:

Sequence, based on SEQRES records: (download)

>d4h9ya_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyngegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfs

Sequence, based on observed residues (ATOM records): (download)

>d4h9ya_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyppyfqfrrllgtaeddiydmfm
aeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqegtmgpe
qaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptdeervr
tllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipalknegi
rdevleqmfignpaalfs

SCOPe Domain Coordinates for d4h9ya_:

Click to download the PDB-style file with coordinates for d4h9ya_.
(The format of our PDB-style files is described here.)

Timeline for d4h9ya_: