Lineage for d4knzb_ (4knz B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666674Protein Thymidylate synthase [55833] (7 species)
  7. 1666689Species Escherichia coli [TaxId:562] [55834] (64 PDB entries)
  8. 1666693Domain d4knzb_: 4knz B: [192990]
    automated match to d2g8oa_
    complexed with cb3, na, umc

Details for d4knzb_

PDB Entry: 4knz (more details), 1.3 Å

PDB Description: thymidylate synthase ternary complex with dump and cb3717
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4knzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4knzb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d4knzb_:

Click to download the PDB-style file with coordinates for d4knzb_.
(The format of our PDB-style files is described here.)

Timeline for d4knzb_: