SCOPe 2.07: Domain d4knzb_: 4knz B:

Lineage for d4knzb_ (4knz B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)

8. Domain d4knzb_: 4knz B: [192990]
   automated match to d2g8oa_
   complexed with cb3, na, umc

Details for d4knzb_

PDB Entry: 4knz, 1.3 Å

PDB Description: thymidylate synthase ternary complex with dump and cb3717

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4knzb_:

Sequence; same for both SEQRES and ATOM records:

>d4knzb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d4knzb_:

• d4knzb_ first appeared in SCOPe 2.02
  
• d4knzb_ appears in SCOPe 2.06
  
• d4knzb_ does not appear in SCOPe 2.08