Lineage for d4al9g_ (4al9 G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530704Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 1530705Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 1530706Species Pseudomonas aeruginosa [TaxId:287] [82024] (14 PDB entries)
  8. 1530760Domain d4al9g_: 4al9 G: [192906]
    automated match to d3zyha_
    complexed with ca, edo, gla

Details for d4al9g_

PDB Entry: 4al9 (more details), 1.75 Å

PDB Description: crystal structure of the lectin pa-il from pseudomonas aeruginoas in complex with melibiose
PDB Compounds: (G:) PA-I galactophilic lectin

SCOPe Domain Sequences for d4al9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4al9g_ b.18.1.16 (G:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d4al9g_:

Click to download the PDB-style file with coordinates for d4al9g_.
(The format of our PDB-style files is described here.)

Timeline for d4al9g_: