Lineage for d4lbda_ (4lbd A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097656Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 1097657Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 1097666Domain d4lbda_: 4lbd A: [19289]
    complexed with 961

Details for d4lbda_

PDB Entry: 4lbd (more details), 2.5 Å

PDB Description: ligand-binding domain of the human retinoic acid receptor gamma bound to the synthetic agonist bms961
PDB Compounds: (A:) retinoic acid receptor gamma

SCOPe Domain Sequences for d4lbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbda_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlen

SCOPe Domain Coordinates for d4lbda_:

Click to download the PDB-style file with coordinates for d4lbda_.
(The format of our PDB-style files is described here.)

Timeline for d4lbda_: