Lineage for d4lbd__ (4lbd -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins) Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48516] (8 PDB entries) 
Domain d4lbd__: 4lbd - [19289]
Details for d4lbd__
PDB Entry: 4lbd (more details), 2.4 Å
PDB Description: ligand-binding domain of the human retinoic acid receptor gamma bound to the synthetic agonist bms961
SCOP Domain Sequences for d4lbd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbd__ a.123.1.1 (-) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlen
SCOP Domain Coordinates for d4lbd__:
Click to download the PDB-style file with coordinates for d4lbd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lbd__:
- d4lbd__ appears in SCOP 1.57
- d4lbd__ appears in the current release, SCOPe 2.08, called d4lbda_
View in 3D