Lineage for d3dwta_ (3dwt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355069Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2355132Domain d3dwta_: 3dwt A: [192719]
    automated match to d1bzqk_
    complexed with gol

Details for d3dwta_

PDB Entry: 3dwt (more details), 2.9 Å

PDB Description: Structure of CabBCII-10 nanobody
PDB Compounds: (A:) cAbBCII-10

SCOPe Domain Sequences for d3dwta_:

Sequence, based on SEQRES records: (download)

>d3dwta_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlsctasggseysystfslgwfrqapgqereavaaiasmgglt
yyadsvkgrftisrdnakntvtlqmnnlkpedtaiyycaavrgyfmrlpsshnfrywgqg
tqvtvssr

Sequence, based on observed residues (ATOM records): (download)

>d3dwta_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlsctasggssystfslgwfrqapgqereavaaiasmggltyy
adsvkgrftisrdnakntvtlqmnnlkpedtaiyycaavrgyfmrlpsshnfrywgqgtq
vtvssr

SCOPe Domain Coordinates for d3dwta_:

Click to download the PDB-style file with coordinates for d3dwta_.
(The format of our PDB-style files is described here.)

Timeline for d3dwta_: