Lineage for d3v0ma1 (3v0m A:64-346)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898744Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2898880Protein automated matches [190178] (2 species)
    not a true protein
  7. 2898887Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)
  8. 2898947Domain d3v0ma1: 3v0m A:64-346 [192611]
    Other proteins in same PDB: d3v0ma2, d3v0mb2
    automated match to d3sxga_
    complexed with 5gw, bhe, mn, so4; mutant

Details for d3v0ma1

PDB Entry: 3v0m (more details), 1.68 Å

PDB Description: crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-gal derived inhibitor (5gw) and h-antigen acceptor
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3v0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0ma1 c.68.1.9 (A:64-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpk

SCOPe Domain Coordinates for d3v0ma1:

Click to download the PDB-style file with coordinates for d3v0ma1.
(The format of our PDB-style files is described here.)

Timeline for d3v0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v0ma2