Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
Protein automated matches [190178] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries) |
Domain d3v0ma1: 3v0m A:64-346 [192611] Other proteins in same PDB: d3v0ma2, d3v0mb2 automated match to d3sxga_ complexed with 5gw, bhe, mn, so4; mutant |
PDB Entry: 3v0m (more details), 1.68 Å
SCOPe Domain Sequences for d3v0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v0ma1 c.68.1.9 (A:64-346) automated matches {Human (Homo sapiens) [TaxId: 9606]} vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpk
Timeline for d3v0ma1: