Lineage for d3v0ma_ (3v0m A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178199Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1178200Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1178492Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
  6. 1178589Protein automated matches [190178] (3 species)
    not a true protein
  7. 1178596Species Homo sapiens [TaxId:9606] [192605] (8 PDB entries)
  8. 1178599Domain d3v0ma_: 3v0m A: [192611]
    automated match to d3sxga_
    complexed with 5gw, bhe, mn, so4; mutant

Details for d3v0ma_

PDB Entry: 3v0m (more details), 1.68 Å

PDB Description: crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-gal derived inhibitor (5gw) and h-antigen acceptor
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3v0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0ma_ c.68.1.9 (A:) automated matches {Homo sapiens [TaxId: 9606]}
aigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttig
ltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevra
ykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfy
gssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangie
avwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpk

SCOPe Domain Coordinates for d3v0ma_:

Click to download the PDB-style file with coordinates for d3v0ma_.
(The format of our PDB-style files is described here.)

Timeline for d3v0ma_: