Lineage for d4hgac_ (4hga C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1082971Domain d4hgac_: 4hga C: [192531]
    Other proteins in same PDB: d4hgab_
    automated match to d1kx5b_
    complexed with pc4

Details for d4hgac_

PDB Entry: 4hga (more details), 2.8 Å

PDB Description: Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX
PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d4hgac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hgac_ a.22.1.1 (C:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
vyalkrqgrtlygfg

SCOPe Domain Coordinates for d4hgac_:

Click to download the PDB-style file with coordinates for d4hgac_.
(The format of our PDB-style files is described here.)

Timeline for d4hgac_: