SCOPe 2.03: Domain d4hgac_: 4hga C:

Lineage for d4hgac_ (4hga C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (11 PDB entries)

8. Domain d4hgac_: 4hga C: [192531]
   Other proteins in same PDB: d4hgab_
   automated match to d1kx5b_
   complexed with pc4

Details for d4hgac_

PDB Entry: 4hga, 2.8 Å

PDB Description: Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX

PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d4hgac_:

Sequence; same for both SEQRES and ATOM records:

>d4hgac_ a.22.1.1 (C:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
vyalkrqgrtlygfg

Timeline for d4hgac_:

• d4hgac_ first appeared in SCOPe 2.02
  
• d4hgac_ appears in SCOPe 2.04
  
• d4hgac_ appears in the current release, SCOPe 2.08