Lineage for d4g7oc_ (4g7o C:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249907Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 2249940Protein RNA-polymerase beta [64488] (2 species)
  7. 2249946Species Thermus thermophilus [TaxId:274] [75609] (9 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 2249951Domain d4g7oc_: 4g7o C: [192522]
    Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7od_, d4g7oe_, d4g7of1, d4g7of2, d4g7of3, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7on_, d4g7oo_, d4g7op1, d4g7op2, d4g7op3
    automated match to d1smyc_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7oc_

PDB Entry: 4g7o (more details), 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d4g7oc_:

Sequence, based on SEQRES records: (download)

>d4g7oc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglask

Sequence, based on observed residues (ATOM records): (download)

>d4g7oc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieelvld
fleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsf
iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvn
krkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgdp
pkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflptl
rylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgsedsl
tpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfdv
rdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvymt
ateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnli
pflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvd
gnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfla
lgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdip
hlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvkd
tslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnkg
vvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispifd
gakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkelf
lqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqf
ggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrv
lvkelqalaldvqtldekdnpvdifeglask

SCOPe Domain Coordinates for d4g7oc_:

Click to download the PDB-style file with coordinates for d4g7oc_.
(The format of our PDB-style files is described here.)

Timeline for d4g7oc_: