PDB entry 4g7o

View 4g7o on RCSB PDB site
Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
Class: transcription, transferase/DNA
Keywords: protein-DNA complex, transcription initiation complex, RNAP-promoter complex, RNAP-promoter open complex, open complex, RPo, RNA polymerase, transcription initiation, transcription Initiation factor sigma A, promoter DNA, nucleoid, TRANSCRIPTION, TRANSFERASE-DNA complex
Deposited on 2012-07-20, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7oa1, d4g7oa2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7ob1, d4g7ob2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7oc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7od_
  • Chain 'E':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7oe_
  • Chain 'F':
    Compound: RNA polymerase sigma factor
    Species: Thermus thermophilus [TaxId:300852]
    Gene: rpoD, TTHA0532
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7of1, d4g7of2, d4g7of3
  • Chain 'G':
    Compound: 5'-d(*cp*cp*t*gp*cp*ap*tp*cp*cp*gp*tp*gp*ap*gp*tp*cp*gp*ap*gp*gp*g)-3'
  • Chain 'H':
    Compound: 5'-d(*tp*ap*tp*ap*ap*tp*gp*gp*gp*ap*gp*cp*tp*gp*tp*cp*ap*cp*gp*gp*ap*tp*gp*cp*ap*gp*g)-3'
  • Chain 'I':
    Compound: 5'-r(*gp*a)-3'
  • Chain 'K':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7ok1, d4g7ok2
  • Chain 'L':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7ol1, d4g7ol2
  • Chain 'M':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7om_
  • Chain 'N':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7on_
  • Chain 'O':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7oo_
  • Chain 'P':
    Compound: RNA polymerase sigma factor
    Species: Thermus thermophilus [TaxId:300852]
    Gene: rpoD, TTHA0532
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g7op1, d4g7op2, d4g7op3
  • Chain 'Q':
    Compound: 5'-d(*cp*cp*t*gp*cp*ap*tp*cp*cp*gp*tp*gp*ap*gp*tp*cp*gp*ap*gp*gp*g)-3'
  • Chain 'R':
    Compound: 5'-d(*tp*ap*tp*ap*ap*tp*gp*gp*gp*ap*gp*cp*tp*gp*tp*cp*ap*cp*gp*gp*ap*tp*gp*cp*ap*gp*g)-3'
  • Chain 'S':
    Compound: 5'-r(*gp*a)-3'
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g7oA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oA (A:)
    sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlh
    efstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadveim
    npdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafqved
    trlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g7oB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oB (B:)
    kapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhefs
    tipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadveimnpd
    lhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafqvedtrl
    gqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4g7oC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieelvld
    fleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsf
    iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvn
    krkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgdp
    pkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflptl
    rylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgsedsl
    tpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfdv
    rdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvymt
    ateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnli
    pflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvd
    gnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfla
    lgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdip
    hlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvkd
    tslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnkg
    vvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispifd
    gakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkelf
    lqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqf
    ggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrv
    lvkelqalaldvqtldekdnpvdifeglask
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4g7oD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oD (D:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkdg
    eevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgeil
    aelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekgq
    plaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarve
    agdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvla
    dggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemk
    hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
    lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrs
    ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
    ekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
    gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
    rdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyv
    fanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliql
    dvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkq
    yleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyv
    maqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
    dtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradiea
    glygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcq
    kcygydlsmarpvsigeavgivaaqsigepgtqltitqglprvielfearrpkakavise
    idgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrgaidphqll
    eakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsrllegqvle
    kwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkk
    deliglkenvilgrlipagtgsdfvrftqvvdqktlkaieea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4g7oE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    vtwamkelltgrlvfgenlvpedrlqkemerlypveree
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
    twamkelltgrlvfgenlvpedrlqkemerlypv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4g7oF (F:)
    mgsshhhhhhssglvprgshmkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdl
    edpdltleddlldlpeegegldleeeeedlpipkistsdpvrqylheigqvplltleeev
    elarkveegmeaikklseitgldpdlirevvrakilgsarvrhipglketldpktveeid
    qklkslpkehkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldliqegnqgl
    iravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinklsrtarqlqq
    elgreptyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygdfipdehlps
    pvdaatqsllseelekalsklsereamvlklrkglidgrehtleevgaffgvtrerirqi
    enkalrklkyhesrtrklrdfld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oF (F:)
    sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
    sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
    iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
    iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
    etpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglid
    grehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4g7oK (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oK (K:)
    sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlh
    efstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadveim
    npdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafqved
    trlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4g7oL (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oL (L:)
    sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlh
    efstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadveim
    npdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafqved
    trlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4g7oM (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oM (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieelvld
    fleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsf
    iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvn
    krkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgdp
    pkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflptl
    rylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgsedsl
    tpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfdv
    rdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvymt
    ateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnli
    pflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvd
    gnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfla
    lgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdip
    hlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvkd
    tslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnkg
    vvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispifd
    gakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkelf
    lqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqf
    ggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrv
    lvkelqalaldvqtldekdnpvdifeglask
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4g7oN (N:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oN (N:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkdg
    eevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgeil
    aelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekgq
    plaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarve
    agdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvla
    dggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemk
    hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
    lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrs
    ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
    ekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
    gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
    rdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyv
    fanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliql
    dvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkq
    yleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyv
    maqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
    dtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradiea
    glygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcq
    kcygydlsmarpvsigeavgivaaqsigepgtqltmvagaaditqglprvielfearrpk
    akaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrga
    idphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsrl
    legqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlte
    aaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieea
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4g7oO (O:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    vtwamkelltgrlvfgenlvpedrlqkemerlypveree
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oO (O:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
    twamkelltgrlvfgenlvpedrlqkemerlypv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4g7oP (P:)
    mgsshhhhhhssglvprgshmkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdl
    edpdltleddlldlpeegegldleeeeedlpipkistsdpvrqylheigqvplltleeev
    elarkveegmeaikklseitgldpdlirevvrakilgsarvrhipglketldpktveeid
    qklkslpkehkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldliqegnqgl
    iravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinklsrtarqlqq
    elgreptyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygdfipdehlps
    pvdaatqsllseelekalsklsereamvlklrkglidgrehtleevgaffgvtrerirqi
    enkalrklkyhesrtrklrdfld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7oP (P:)
    tsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakil
    gsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvv
    siakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqar
    tiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvs
    letpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkgli
    dgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.